ExactAntigen

Mouse Monoclonal anti-PCSK1 (3D2) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00005122-M02
ProductName: PCSK1 Antibody
Product Description: Mouse Monoclonal anti-PCSK1 (3D2)
Clone: 3D2
Clonality: Monoclonal
Immunogen: PCSK1 (NP_000430, 652 a.a. ~ 754 a.a) partial recombinant protein with GST tag.
Epitope: GGRRDELEEGAPSQAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background: The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a type I proinsulin-processing enzyme that plays a key role in regulating insulin biosynthesis. It is also known to cleave proopiomelanocortin, prorenin, proenkephalin, prodynorphin, prosomatostatin and progastrin. Mutations in this gene are thought to cause obesity. This encoded protein is associated with carcinoid tumors. The use of alternate polyadenylation sites has been found for this gene. Multiple alternatively spliced transcript variants have been described for this gene but their full length nature is not known.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG3 Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB, IHC-P
SpeciesSummary: Hu
ALTnames: anti-NEC1 antibody, anti-PC1 antibody, anti-PC3 antibody, anti-SPC3 antibody
ProteinTarget: proprotein convertase subtilisin/kexin type 1
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 5122
Gene_Symbol: PCSK1
Omim_ID: 162150, 600955,
more information: company product webpage
Also see:
see all human PCSK1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about