ExactAntigen

PCNA Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005111-M11
Product Type:Primary Antibody
Product Name:PCNA Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5111
Host:Mouse
Clone:3G8
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-PCNA (3G8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage,
Alternate Names:anti-MGC8367 antibody
Immunogen:PCNA (NP_002583, 78 a.a. ~ 177 a.a) full length recombinant protein with GST tag.
Epitope:ILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGN ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is
Gene Symbol:PCNA
Omim ID:176740,
see all human PCNA antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about