ExactAntigen

Mouse Monoclonal anti-PCMT1 (4G9) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00005110-M01
ProductName: PCMT1 Antibody
Product Description: Mouse Monoclonal anti-PCMT1 (4G9)
Clone: 4G9
Clonality: Monoclonal
Immunogen: PCMT1 (AAH07501, 1 a.a. ~ 229 a.a) full length recombinant protein with GST tag.
Epitope: MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRDEL* ...
Specificity: PCMT1 - protein-L-isoaspartate (D-aspartate) O-methyltransferase
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background: Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.[supplied by OMIM]
Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ProteinTarget: PCMT1 - protein-L-isoaspartate (D-aspartate) O-methyltransferase
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 5110
Gene_Symbol: PCMT1
Omim_ID: 176851,
more information: company product webpage
Also see:
see all human PCMT1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about