| CatalogCode: | H00005097-M04 |
| ProductName: | protocadherin 1 Antibody |
| Product Description: | Mouse Monoclonal anti-protocadherin 1 (2E6-1B10) |
| Clone: | 2E6-1B10 |
| Clonality: | Monoclonal |
| Immunogen: | PCDH1 (NP_002578, 62 a.a. ~ 170 a.a) partial recombinant protein with GST tag. |
| Epitope: | YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA* ... |
| Specificity: | protocadherin 1 (cadherin-like 1) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene belongs to the protocadherin subfamily within the cadherin superfamily. The encoded protein is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity. Alternative splicing occurs in this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MGC45991 antibody, anti-PC42 antibody, anti-PCDH42 antibody |
| ProteinTarget: | protocadherin 1 (cadherin-like 1) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 5097 |
| Gene_Symbol: | PCDH1 |
| Omim_ID: | 603626, |
order or
more information: | company product webpage |
| request information: |
|