ExactAntigen

Mouse Polyclonal anti-PAX9 - paired box gene 9, MaxPab Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00005083-B01
ProductName:PAX9 Antibody
Product Description:Mouse Polyclonal anti-PAX9 - paired box gene 9, MaxPab Antibody
Clonality:Polyclonal
Immunogen:PAX9 (-, 1 a.a. ~ 341 a.a) full-length human protein.
Epitope:MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVPAIPGSVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKY ...
CrossReactivity:Human.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Background:This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 9 gene is unknown but it may involve development of stratified squamous epithelia as well as various organs and skeletal elements.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:295
AppSummary:WB, ELISA
SpeciesSummary:Hu
ProteinTarget:paired box gene 9
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id:5083
Gene_Symbol:PAX9
see all human PAX9 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about