ExactAntigen

Mouse Monoclonal anti-PAX7 (4F8) | Novus Biologicals antibody product information
CatalogCode:H00005081-M09
ProductName:PAX7 Antibody
Product Description:Mouse Monoclonal anti-PAX7 (4F8)
Clone:4F8
Clonality:Monoclonal
Immunogen:PAX7 (NP_002575, 411 a.a. ~ 521 a.a) partial recombinant protein with GST tag.
Epitope:GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-HUP1 antibody
ProteinTarget:paired box gene 7
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:5081
Gene_Symbol:PAX7
Omim_ID:167410, 268220,
order or
more information
:
company product webpage
request information:
Also see:
all human PAX7 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about