ExactAntigen

PAX2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005076-A01
Product Type:Primary Antibody
Product Name:PAX2 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:5076
Host:Mouse
Product Description:Mouse Polyclonal anti-PAX2
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcrip
Immunogen:PAX2 (NP_000269, 194 a.a. ~ 304 a.a) partial recombinant protein with GST tag.
Epitope:PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP* ...
Specificity:PAX2 - paired box gene 2
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PAX2
Omim ID:120330 167409
see all human PAX2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about