| Catalog Code: | H00005058-M02 |
| Product Type: | Primary Antibody |
| Product Name: | PAK1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 5058 |
| Host: | Mouse |
| Clone: | 4D1 |
| Isotype: | IgG1 kappa |
| Product Description: | Mouse Monoclonal anti-PAK1 (4D1) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = PAK1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.PAK proteins are cri |
| Alternate Names: | anti-PAK1 antibody, anti-p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog antibody, anti-yeast)antibody, anti-MGC130000 antibody, anti-MGC130001 antibody, anti-PAKalphaantibody, anti-p21-activated kinase 1 antibody, anti-p21/Cdc42/Rac1-activated kinase 1 |
| Immunogen: | PAK1 (NP_002567, 191 a.a. ~ 280 a.a) partial recombinant protein with GST tag. |
| Epitope: | APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA ... |
| Specificity: | PAK1 - p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast) |
| Purity: | IgG purified |
| Packaging: | 0.1 ml IgG purified Mouse ascites. |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis |
| Application Summary: | ELISA, WB, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PAK1 |
| Omim ID: | 602590 |