ExactAntigen

PAK1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005058-M01
Product Type:Primary Antibody
Product Name:PAK1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5058
Host:Mouse
Clone:1E11
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-PAK1 (1E11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = PAK1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.PAK proteins are cri
Alternate Names:anti-PAK1 antibody, anti-p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog antibody, anti-yeast)antibody, anti-MGC130000 antibody, anti-MGC130001 antibody, anti-PAKalphaantibody, anti-p21-activated kinase 1 antibody, anti-p21/Cdc42/Rac1-activated kinase 1
Immunogen:PAK1 (NP_002567, 191 a.a. ~ 280 a.a) partial recombinant protein with GST tag.
Epitope:APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA ...
Specificity:PAK1 - p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections.
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PAK1
Omim ID:602590
see all human PAK1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about