ExactAntigen

SERPINB2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005055-M08
Product Type:Primary Antibody
Product Name:SERPINB2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5055
Host:Mouse
Clone:3A9
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-SERPINB2 (3A9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-HsT1201 antibody, anti-PAI antibody, anti-PAI-2 antibody, anti-PAI2 antibody, anti-PLANH2 antibody
Immunogen:SERPINB2 (AAH12609, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Epitope:MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPENFTSCGFMQQIQKGSYPDAILQAQAA ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:100 ug purified IgG
Package Size:100 ug
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SERPINB2
Omim ID:173390,
see all human SERPINB2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about