ExactAntigen

Mouse Polyclonal anti-PAFAH2
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00005051-A01
ProductName:PAFAH2 Antibody
Product Description:Mouse Polyclonal anti-PAFAH2
Clonality:Polyclonal
Immunogen:PAFAH2 (NP_000428, 293 a.a. ~ 393 a.a) partial recombinant protein with GST tag.
Epitope:LMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL* ...
Specificity:PAFAH2 - platelet-activating factor acetylhydrolase 2, 40kDa
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background:This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-HSD-PLA2 antibody
ProteinTarget:PAFAH2 - platelet-activating factor acetylhydrolase 2, 40kDa
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:5051
Gene_Symbol:PAFAH2
Omim_ID:602344 H00005051-B01
see all human PAFAH2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about