| CatalogCode: | H00005047-B01 |
| ProductType: | Primary Antibody |
| ProductName: | PAEP Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 5047 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-PAEP - progestagen-associated endometrial protein (placental protein 14, pregnancy-associated endometrial alpha-2-globulin, alpha uterine protein), MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromo |
| ALTnames: | anti-GD antibody, anti-GdA antibody, anti-GdF antibody, anti-GdS antibody, anti-MGC138509 antibody, anti-PAEG antibody, anti-PEP antibody, anti-PP14 antibody |
| Immunogen: | PAEP (-, 1 a.a. ~ 180 a.a) full-length human protein. |
| Epitope: | MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |