ExactAntigen

PAEP Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005047-A01
Product Type:Primary Antibody
Product Name:PAEP Antibody
List Price:205
Clonality:Polyclonal
Gene ID:5047
Host:Mouse
Product Description:Mouse Polyclonal anti-PAEP
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = 5047 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-GD antibody, anti-GdA antibody, anti-GdF antibody, anti-GdS antibody, anti-MGC138509 antibody, anti-PAEG antibody, anti-PEP antibody, anti-PP14 antibody
Immunogen:PAEP (NP_002562, 53 a.a. ~ 163 a.a) partial recombinant protein with GST tag.
Epitope:NLEIVLHRWENNSCVEKKVLGEKTGNPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF* ...
Specificity:PAEP - progestagen-associated endometrial protein (placental protein 14, pregnancy-associated endometrial alpha-2-globulin, alpha uterine protein)
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PAEP
Omim ID:173310
see all human PAEP antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about