ExactAntigen

P2RX5 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005026-M01
Product Type:Primary Antibody
Product Name:P2RX5 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5026
Host:Mouse
Clone:1C5
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-P2RX5 (1C5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = P2RX5 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The product of this
Alternate Names:anti-MGC47755 antibody, anti-P2X5 antibody, anti-P2X5R antibody
Immunogen:P2RX5 (NP_002552, 126 a.a. ~ 225 a.a) partial recombinant protein with GST tag.
Epitope:DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP* ...
Specificity:P2RX5 - purinergic receptor P2X, ligand-gated ion channel, 5
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been tested on transfected lysates
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:P2RX5
Omim ID:602836,
see all human P2RX5 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about