ExactAntigen

Mouse Monoclonal anti-OTX1 (4E5) | Novus Biologicals antibody product information
CatalogCode:H00005013-M03
ProductName:OTX1 Antibody
Product Description:Mouse Monoclonal anti-OTX1 (4E5)
Clone:4E5
Clonality:Monoclonal
Immunogen:OTX1 (NP_055377, 10 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
Epitope:YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-FLJ38361 antibody, anti-MGC15736 antibody
ProteinTarget:orthodenticle homolog 1 (Drosophila)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:5013
Gene_Symbol:OTX1
Omim_ID:600036,
order or
more information
:
company product webpage
request information:
Also see:
all human OTX1 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about