ExactAntigen

OSM Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005008-B01
Product Type:Primary Antibody
Product Name:OSM Antibody
List Price:275
Clonality:Polyclonal
Gene ID:5008
Host:Mouse
Clone:oncostatin M
Product Description:Mouse Polyclonal anti-OSM - oncostatin M
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It reg
Alternate Names:anti-MGC20461 antibody
Immunogen:OSM (AAH11589, 1 a.a. ~ 253 a.a) full-length human protein.
Epitope:MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR* ...
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is
Gene Symbol:OSM
see all human oncostatin M antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about