| Catalog Code: | H00005008-B01 |
| Product Type: | Primary Antibody |
| Product Name: | OSM Antibody |
| List Price: | 275 |
| Clonality: | Polyclonal |
| Gene ID: | 5008 |
| Host: | Mouse |
| Clone: | oncostatin M |
| Product Description: | Mouse Polyclonal anti-OSM - oncostatin M |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It reg |
| Alternate Names: | anti-MGC20461 antibody |
| Immunogen: | OSM (AAH11589, 1 a.a. ~ 253 a.a) full-length human protein. |
| Epitope: | MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR* ... |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | WB, ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is |
| Gene Symbol: | OSM |