ExactAntigen

oxidised low density lipoprotein Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004973-M08
Product Type:Primary Antibody
Product Name:oxidised low density lipoprotein Antibody
List Price:275
Clonality:Monoclonal
Gene ID:4973
Host:Mouse
Clone:2C9
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-oxidised low density lipoprotein (2C9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Genbank acession number is BC022295. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encod
Alternate Names:anti-CLEC8A antibody, anti-LOX1 antibody, anti-SCARE1 antibody
Immunogen:OLR1 (AAH22295, 1 a.a. ~ 274 a.a) full length recombinant protein with GST tag.
Epitope:MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAEN ...
Specificity:oxidised low density lipoprotein (lectin-like) receptor 1
Purity:IgG purified
Buffer:1X PBS pH 7.2
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug).
Gene Symbol:OLR1
Omim ID:602601,
see all human OLR1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about