ExactAntigen

Mouse Polyclonal anti-OGN - osteoglycin (osteoinductive factor, mimecan) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00004969-B01
ProductName: OGN Antibody
Product Description: Mouse Polyclonal anti-OGN - osteoglycin (osteoinductive factor, mimecan)
Clone: osteoglycin (osteoinductive factor, mime
Clonality: Polyclonal
Immunogen: OGN (AAH37273, 1 a.a. ~ 299 a.a) full-length human protein.
Epitope: MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFC ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: This gene encodes a protein which induces ectopic bone formation in conjunction with transforming growth factor beta. This protein is a small proteoglycan which contains tandem leucine-rich repeats (LRR). Alternatively spliced transcript variants that encode the same protein have been found for this gene.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 295
AppSummary: WB, ELISA
SpeciesSummary: Hu
ALTnames: anti-DKFZP586P2421 antibody, anti-OIF antibody, anti-SLRR3A antibody
ProteinTarget: osteoglycin (osteoinductive factor, mimecan)
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id: 4969
Gene_Symbol: OGN
more information: company product webpage
Also see:
see all human OGN antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about