| CatalogCode: | | H00004958-B01 |
| ProductName: | | OMD Antibody |
| Product Description: | | Mouse Polyclonal anti-OMD - osteomodulin, MaxPab Antibody |
| Clonality: | | Polyclonal |
| Immunogen: | | OMD (-, 1 a.a. ~ 421 a.a) full-length human protein. |
| Epitope: | | MGFLSPIYVIFFFFGVKVHCQYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDK ... |
| CrossReactivity: | | Human. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | WB, ELISA |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-OSAD antibody, anti-SLRR2C antibody |
| ProteinTarget: | | osteomodulin |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | | 4958 |
| Gene_Symbol: | | OMD |
| more information: | | company product webpage |