ExactAntigen

Mouse Polyclonal anti-OMD - osteomodulin, MaxPab Antibody | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00004958-B01
ProductName: OMD Antibody
Product Description: Mouse Polyclonal anti-OMD - osteomodulin, MaxPab Antibody
Clonality: Polyclonal
Immunogen: OMD (-, 1 a.a. ~ 421 a.a) full-length human protein.
Epitope: MGFLSPIYVIFFFFGVKVHCQYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDK ...
CrossReactivity: Human.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 295
AppSummary: WB, ELISA
SpeciesSummary: Hu
ALTnames: anti-OSAD antibody, anti-SLRR2C antibody
ProteinTarget: osteomodulin
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id: 4958
Gene_Symbol: OMD
more information: company product webpage
Also see:
see all human osteoadherin antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about