| Catalog Code: | H00004950-A01 |
| Product Type: | Primary Antibody |
| Product Name: | OCLN Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 4950 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-OCLN |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the f |
| Immunogen: | OCLN (NP_002529, 423 a.a. ~ 523 a.a) partial recombinant protein with GST tag. |
| Epitope: | ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT* ... |
| Specificity: | OCLN - occludin |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. No preservative. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | OCLN |
| Omim ID: | 602876 |