ExactAntigen

OCLN Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004950-A01
Product Type:Primary Antibody
Product Name:OCLN Antibody
List Price:205
Clonality:Polyclonal
Gene ID:4950
Host:Mouse
Product Description:Mouse Polyclonal anti-OCLN
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the f
Immunogen:OCLN (NP_002529, 423 a.a. ~ 523 a.a) partial recombinant protein with GST tag.
Epitope:ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT* ...
Specificity:OCLN - occludin
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:OCLN
Omim ID:602876
see all human occludin antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about