| Catalog Code: | H00004938-M01 |
| Product Type: | Primary Antibody |
| Product Name: | OAS1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 4938 |
| Host: | Mouse |
| Clone: | 2D4 |
| Isotype: | IgG2a |
| Product Description: | Mouse Monoclonal anti-OAS1 (2D4) |
| Cross Reactivity: | Only been tested against the immunogen |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = 4938 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes a |
| Alternate Names: | anti-oligoadenylate synthetase 1 antibody, anti-40/46kDa antibody, anti-IFI-4 antibody, anti-OIAS andtibody antibody, anti-OIASI antibody |
| Immunogen: | OAS1 (AAH00562, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Epitope: | SVSRRDKSKQVWEAVLLPLSLLSMMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDAD ... |
| Purity: | IgG purified |
| Buffer: | PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | OAS1 |
| Omim ID: | 164350, |