ExactAntigen

OAS1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004938-M01
Product Type:Primary Antibody
Product Name:OAS1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:4938
Host:Mouse
Clone:2D4
Isotype:IgG2a
Product Description:Mouse Monoclonal anti-OAS1 (2D4)
Cross Reactivity:Only been tested against the immunogen
Species Summary:Hu
Background:NCBI Entrez Gene ID = 4938 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes a
Alternate Names:anti-oligoadenylate synthetase 1 antibody, anti-40/46kDa antibody, anti-IFI-4 antibody, anti-OIAS andtibody antibody, anti-OIASI antibody
Immunogen:OAS1 (AAH00562, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Epitope:SVSRRDKSKQVWEAVLLPLSLLSMMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDAD ...
Purity:IgG purified
Buffer:PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:OAS1
Omim ID:164350,
see all human OAS1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about