| Catalog Code: | H00004922-B01 |
| Product Type: | Primary Antibody |
| Product Name: | NTS Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 4922 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-NTS - neurotensin, MaxPab Antibody |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a common precursor for two peptides, neuromedin N and neurotensin. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. I |
| Alternate Names: | anti-NMN-125 antibody, anti-NN antibody, anti-NT antibody, anti-NT/N antibody, anti-NTS1 antibody |
| Immunogen: | NTS (NP_006174, 1 a.a. ~ 170 a.a) full-length human protein. |
| Epitope: | MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |