ExactAntigen

NTS Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004922-B01
Product Type:Primary Antibody
Product Name:NTS Antibody
List Price:295
Clonality:Polyclonal
Gene ID:4922
Host:Mouse
Product Description:Mouse Polyclonal anti-NTS - neurotensin, MaxPab Antibody
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a common precursor for two peptides, neuromedin N and neurotensin. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. I
Alternate Names:anti-NMN-125 antibody, anti-NN antibody, anti-NT antibody, anti-NT/N antibody, anti-NTS1 antibody
Immunogen:NTS (NP_006174, 1 a.a. ~ 170 a.a) full-length human protein.
Epitope:MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY ...
Preservative:No Preservative
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
see all human neurotensin antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about