| CatalogCode: | H00004864-M02 |
| ProductName: | NPC1 Antibody |
| Product Description: | Mouse Monoclonal anti-NPC1 (4H2) |
| Clone: | 4H2 |
| Clonality: | Monoclonal |
| Immunogen: | NPC1 (AAH63302, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. |
| Epitope: | GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK ... |
| Specificity: | NPC1 - Niemann-Pick disease, type C1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene was identified as the gene that when mutated, results in Niemann-Pick C disease. The encoded protein is a putative integral membrane protein that contains motifs consistent with a role in intracellular transport of cholesterol to post-lysosomal destinations. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-NPC antibody |
| ProteinTarget: | NPC1 - Niemann-Pick disease, type C1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 4864 |
| Gene_Symbol: | NPC1 |
| Omim_ID: | 257220; 607623 |
order or
more information: | company product webpage |
| request information: |
|