| CatalogCode: | | H00004802-M01 |
| ProductName: | | NFYC Antibody |
| Product Description: | | Mouse Monoclonal anti-NFYC (1D3) |
| Clone: | | 1D3 |
| Clonality: | | Monoclonal |
| Immunogen: | | NFYC (AAH05003, 14 a.a. ~ 113 a.a) partial recombinant protein with GST tag. |
| Epitope: | | DAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDF ... |
| Specificity: | | NFYC - nuclear transcription factor Y, gamma |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections. |
| Background: | | This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. Additional regulation, preliminarily supported by the EST database, may be represented by alternative splicing in this subunit. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG3 Kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB, IHC-P |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CBF-C antibody, anti-CBFC antibody, anti-DKFZp667G242 antibody, anti-H1TF2A antibody, anti-HAP5 antibody, anti-HSM antibody, anti-NF-YC antibody, anti-hCBF-C antibody |
| ProteinTarget: | | NFYC - nuclear transcription factor Y, gamma |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 4802 |
| Gene_Symbol: | | NFYC |
| Omim_ID: | | 605344 H00058157-A01 |
| more information: | | company product webpage |