ExactAntigen

NFYA Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004800-M01
Product Type:Primary Antibody
Product Name:NFYA Antibody
List Price:275
Clonality:Monoclonal
Gene ID:4800
Host:Mouse
Clone:3F9
Isotype:IgM Kappa
Product Description:Mouse Monoclonal anti-NFYA (3F9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = NFYA PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded
Alternate Names:anti-CAAT box DNA binding protein subunit A antibody, anti-CBFA antibody, anti-CBFB antibody, anti-CCAAT binding transcription factor subunit B antibody, anti-HAP2 CCAAT binding protein antibody, anti-Nuclear transcription factor Y alpha antibody, anti-Tr
Immunogen:NFYA (AAH39244, 219 a.a. ~ 318 a.a) partial recombinant protein with GST tag.
Epitope:AIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS ...
Localization:Nuclear
Specificity:NFYA - nuclear transcription factor Y, alpha
Purity:Ascites
Packaging:0.1 ml Mouse ascites.
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NFYA
Omim ID:189903,
see all human NFYA antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about