| Catalog Code: | H00004800-M01 |
| Product Type: | Primary Antibody |
| Product Name: | NFYA Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 4800 |
| Host: | Mouse |
| Clone: | 3F9 |
| Isotype: | IgM Kappa |
| Product Description: | Mouse Monoclonal anti-NFYA (3F9) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = NFYA PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded |
| Alternate Names: | anti-CAAT box DNA binding protein subunit A antibody, anti-CBFA antibody, anti-CBFB antibody, anti-CCAAT binding transcription factor subunit B antibody, anti-HAP2 CCAAT binding protein antibody, anti-Nuclear transcription factor Y alpha antibody, anti-Tr |
| Immunogen: | NFYA (AAH39244, 219 a.a. ~ 318 a.a) partial recombinant protein with GST tag. |
| Epitope: | AIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS ... |
| Localization: | Nuclear |
| Specificity: | NFYA - nuclear transcription factor Y, alpha |
| Purity: | Ascites |
| Packaging: | 0.1 ml Mouse ascites. |
| Package Size: | 0.1 ml |
| Uses: | Antibody reactive against recombinant protein on ELISA. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | NFYA |
| Omim ID: | 189903, |