ExactAntigen

NFKBIB Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004793-M04
Product Type:Primary Antibody
Product Name:NFKBIB Antibody
List Price:275
Clonality:Monoclonal
Gene ID:4793
Host:Mouse
Clone:3B5
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-NFKBIB (3B5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by tr
Alternate Names:anti-IKBB antibody, anti-TRIP9 antibody
Immunogen:NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Epitope:EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NFKBIB
Omim ID:604495,
see all human NFKBIB antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about