| CatalogCode: | | H00004793-M01 |
| ProductName: | | NFKBIB Antibody |
| Product Description: | | Mouse Monoclonal anti-NFKBIB (1B5) |
| Clone: | | 1B5 |
| Clonality: | | Monoclonal |
| Immunogen: | | NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. |
| Epitope: | | EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA ... |
| Specificity: | | NFKBIB - nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody reactive against recombinant protein on ELISA. |
| Background: | | NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM] |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG2a Kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, IHC-P |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-IKBB antibody, anti-TRIP9 antibody |
| ProteinTarget: | | NFKBIB - nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 4793 |
| Gene_Symbol: | | NFKBIB |
| Omim_ID: | | 604495 H00004793-M02 |
| more information: | | company product webpage |