| CatalogCode: | H00004790-B01 |
| ProductType: | Primary Antibody |
| ProductName: | NFKB1 Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 4790 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-NFKB1 - nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 (p105), MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF |
| ALTnames: | anti-DKFZp686C01211 antibody, anti-EBP-1 antibody, anti-KBF1 antibody, anti-MGC54151 antibody, anti-NF-kappa-B antibody, anti-NFKB-p105 antibody, anti-NFKB-p50 antibody |
| Immunogen: | NFKB1 (NP_003989, 1 a.a. ~ 969 a.a) full-length human protein. |
| Epitope: | MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVR ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |