ExactAntigen

NFIC Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004782-M02
Product Type:Primary Antibody
Product Name:NFIC Antibody
List Price:275
Clonality:Monoclonal
Gene ID:4782
Host:Mouse
Clone:2C3
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-NFIC (2C3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = NFIC PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-CTF antibody, anti-CTF5 antibody, anti-MGC20153 antibody, anti-NF-I antibody, anti-NFI antibody
Immunogen:NFIC (NP_005588, 314 a.a. ~ 424 a.a) partial recombinant protein with GST tag.
Epitope:TEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGP* ...
Specificity:NFIC - nuclear factor I/C (CCAAT-binding transcription factor)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NFIC
Omim ID:600729
see all human NFIC antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about