ExactAntigen

nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004775-M02
Product Type:Primary Antibody
Product Name:nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:4775
Host:Mouse
Clone:3A12
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (3A12)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Genbank acession number is NM_173165. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The product of
Alternate Names:anti-NFAT4 antibody, anti-NFATX antibody
Immunogen:NFATC3 (NP_775188, 70 a.a. ~ 150 a.a) partial recombinant protein with GST tag.
Epitope:HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL* ...
Specificity:nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
Purity:IgG purified
Buffer:1X PBS pH 7.2
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug).
Gene Symbol:NFATC3
Omim ID:602698,
see all human NFATC3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about