| Catalog Code: | H00004773-A01 |
| Product Type: | Primary Antibody |
| Product Name: | NFATC2 Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 4773 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-NFATC2 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = 4773 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours. |
| Alternate Names: | anti-KIAA0611 antibody, anti-NFAT1 antibody, anti-NFATP antibody |
| Immunogen: | NFATC2 (NP_036472, 812 a.a. ~ 922 a.a) partial recombinant protein with GST tag. |
| Epitope: | HYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTHLSWIQNIL* ... |
| Specificity: | NFATC2 - nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. No preservative. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<b |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | NFATC2 |
| Omim ID: | 600490 |