| CatalogCode: | | H00004751-M10 |
| ProductName: | | NEK2 Antibody |
| Product Description: | | Mouse Monoclonal anti-NEK2 (1C8) |
| Clone: | | 1C8 |
| Clonality: | | Monoclonal |
| Immunogen: | | NEK2 (AAH43502, 331 a.a. ~ 445 a.a) partial recombinant protein with GST tag. |
| Epitope: | | EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR ... |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG1 Kappa |
| Host_Name: | | Mouse |
| Buffer: | | In 1x PBS, pH 7.2 |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-HsPK 21 antibody, anti-HsPK21 antibody, anti-NEK2A antibody, anti-NLK1 antibody |
| ProteinTarget: | | NIMA (never in mitosis gene a)-related kinase 2 |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 4751 |
| Gene_Symbol: | | NEK2 |
| Omim_ID: | | 604043, |
| more information: | | company product webpage |