ExactAntigen

Mouse Polyclonal anti-NEDD9 | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00004739-A01
ProductName: NEDD9 Antibody
Product Description: Mouse Polyclonal anti-NEDD9
Clonality: Polyclonal
Immunogen: NEDD9 (NP_006394, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag.
Epitope: PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPV* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.051 ml of mouse antisera with 50% glycerol.
Uses: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-CAS-L antibody, anti-CASL antibody, anti-HEF1 antibody, anti-dJ49G10.2 antibody, anti-dJ761I2.1 antibody, anti-neural antibody
ProteinTarget: neural precursor cell expressed, developmentally down-regulated 9
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 4739
Gene_Symbol: NEDD9
Omim_ID: 602265,
more information: company product webpage
Also see:
see all human NEDD9 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about