| CatalogCode: | H00004692-M05 |
| ProductName: | NDN Antibody |
| Product Description: | Mouse Monoclonal anti-NDN (3B9) |
| Clone: | 3B9 |
| Clonality: | Monoclonal |
| Immunogen: | NDN (NP_002478, 222 a.a. ~ 322 a.a) partial recombinant protein with GST tag. |
| Epitope: | WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED* ... |
| Specificity: | NDN - necdin homolog (mouse) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-HsT16328 antibody |
| ProteinTarget: | NDN - necdin homolog (mouse) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 4692 |
| Gene_Symbol: | NDN |
| Omim_ID: | 176270, 602117, |
order or
more information: | company product webpage |
| request information: |
|