ExactAntigen

Mouse Monoclonal anti-NDN (1B3) | Novus Biologicals antibody product information
CatalogCode:H00004692-M02
ProductName:NDN Antibody
Product Description:Mouse Monoclonal anti-NDN (1B3)
Clone:1B3
Clonality:Monoclonal
Immunogen:NDN (NP_002478, 222 a.a. ~ 322 a.a) partial recombinant protein with GST tag.
Epitope:WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED* ...
Specificity:NDN - necdin homolog (mouse)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background:This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB, IHC-P
SpeciesSummary:Hu
ALTnames:anti-HsT16328 antibody
ProteinTarget:NDN - necdin homolog (mouse)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:4692
Gene_Symbol:NDN
Omim_ID:176270, 602117,
order or
more information
:
company product webpage
request information:
Also see:
all human necdin antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about