| CatalogCode: | H00004488-M04 |
| ProductName: | MSX2 Antibody |
| Product Description: | Mouse Monoclonal anti-MSX2 (1F6) |
| Clone: | 1F6 |
| Clonality: | Monoclonal |
| Immunogen: | MSX2 (NP_002440, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. |
| Epitope: | TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CRS2 antibody, anti-FPP antibody, anti-HOX8 antibody, anti-MSH antibody, anti-PFM antibody, anti-PFM1 antibody |
| ProteinTarget: | msh homeobox homolog 2 (Drosophila) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 4488 |
| Gene_Symbol: | MSX2 |
| Omim_ID: | 123101, 168500, 168550, 604757, |
order or
more information: | company product webpage |
| request information: |
|