ExactAntigen

MSN Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004478-M13
Product Type:Primary Antibody
Product Name:MSN Antibody
List Price:295
Clonality:Monoclonal
Gene ID:4478
Host:Mouse
Clone:4B8
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-MSN - moesin (4B8)
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement.
Immunogen:MSN (NP_002435, 422 a.a. ~ 532 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:AELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELAN* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Packaging:0.1 mg IgG purified Mouse ascites.
PackageSize:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, , Western Blot 1:500
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human moesin antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about