| Catalog Code: | H00004478-M13 |
| Product Type: | Primary Antibody |
| Product Name: | MSN Antibody |
| List Price: | 295 |
| Clonality: | Monoclonal |
| Gene ID: | 4478 |
| Host: | Mouse |
| Clone: | 4B8 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-MSN - moesin (4B8) |
| Cross Reactivity: | Human. |
| Species Summary: | Hu(+) |
| Background: | Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement. |
| Immunogen: | MSN (NP_002435, 422 a.a. ~ 532 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Epitope: | AELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELAN* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Preservative: | No Preservative |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| PackageSize: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, , Western Blot 1:500 |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| WebLink: | www.novusbio.com/data_sheet/index ... |