| CatalogCode: | H00004296-A01 |
| ProductName: | mitogen-activated protein kinase kinase kinase 11 Antibody |
| Product Description: | Mouse Polyclonal anti-mitogen-activated protein kinase kinase kinase 11 |
| Clonality: | Polyclonal |
| Immunogen: | MAP3K11 (NP_002410, 741 a.a. ~ 848 a.a) partial recombinant protein with GST tag. |
| Epitope: | PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP* ... |
| Specificity: | mitogen-activated protein kinase kinase kinase 11 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase contains a SH3 domain and a leucine zipper-basic motif. This kinase preferentially activates MAPK8/JNK kinase, and functions as a positive regulator of JNK signaling pathway. This kinase can directly phosphorylate, and activates IkappaB kinase alpha and beta, and is found to be involved in the transcription activity of NF-kappaB mediated by Rho family GTPases and CDC42. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MGC17114 antibody, anti-MLK-3 antibody, anti-MLK3 antibody, anti-PTK1 antibody, anti-SPRK antibody |
| ProteinTarget: | mitogen-activated protein kinase kinase kinase 11 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 4296 |
| Gene_Symbol: | MAP3K11 |
| Omim_ID: | 600050, |