| CatalogCode: | H00004207-M06 |
| ProductName: | MEF2B Antibody |
| Product Description: | Mouse Monoclonal anti-MEF2B (4A2) |
| Clone: | 4A2 |
| Clonality: | Monoclonal |
| Immunogen: | MEF2B (AAH04449, 1 a.a. ~ 110 a.a) full length recombinant protein with GST tag. |
| Epitope: | MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHR* ... |
| Specificity: | MEF2B - MADS box transcription enhancer factor 2, polypeptide B (myocyte enhancer factor 2B) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-FLJ32599 antibody, anti-FLJ46391 antibody, anti-RSRFR2 antibody |
| ProteinTarget: | MEF2B - MADS box transcription enhancer factor 2, polypeptide B (myocyte enhancer factor 2B) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 4207 |
| Gene_Symbol: | MEF2B |
| Omim_ID: | 600661, |
order or more information: | company product webpage |
| request information: | |