ExactAntigen

Mouse Monoclonal anti-MEF2B (2H7) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00004207-M02
ProductName: MEF2B Antibody
Product Description: Mouse Monoclonal anti-MEF2B (2H7)
Clone: 2H7
Clonality: Monoclonal
Immunogen: MEF2B (AAH04449, 1 a.a. ~ 110 a.a) full length recombinant protein with GST tag.
Epitope: MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVHFRSVEGLLKQAISIRDHMNASAQGHR* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody reactive against recombinant protein on ELISA.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2b Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA
SpeciesSummary: Hu
ALTnames: anti-FLJ32599 antibody, anti-FLJ46391 antibody, anti-RSRFR2 antibody
ProteinTarget: MADS box transcription enhancer factor 2, polypeptide B (myocyte enhancer factor 2B)
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 4207
Gene_Symbol: MEF2B
Omim_ID: 600661,
more information: company product webpage
Also see:
see all human MEF2B antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about