| CatalogCode: | H00004204-M01 |
| ProductName: | MECP2 Antibody |
| Product Description: | Mouse Monoclonal anti-MECP2 (4B6) |
| Clone: | 4B6 |
| Clonality: | Monoclonal |
| Immunogen: | MECP2 (AAH11612, 81 a.a. ~ 170 a.a) partial recombinant protein with GST tag. |
| Epitope: | PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ ... |
| Specificity: | MECP2 - methyl CpG binding protein 2 (Rett syndrome) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections. |
| Background: | DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of some cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB, IHC-P |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DKFZp686A24160 antibody, anti-MRX16 antibody, anti-MRX79 antibody, anti-PPMX antibody, anti-RTS antibody, anti-RTT antibody |
| ProteinTarget: | MECP2 - methyl CpG binding protein 2 (Rett syndrome) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 4204 |
| Gene_Symbol: | MECP2 |
| Omim_ID: | 105830, 300005, 300055, 300279, 300458, 300496, 312750, |
order or
more information: | company product webpage |
| request information: |
|