| CatalogCode: | H00004193-A01 |
| ProductName: | MDM2 Antibody |
| Product Description: | Mouse Polyclonal anti-MDM2 |
| Clonality: | Polyclonal |
| Immunogen: | MDM2 (NP_002383, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. |
| Epitope: | TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC* ... |
| Specificity: | MDM2 - Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | This gene is a target gene of the transcription factor tumor protein p53. The encoded protein is a nuclear phosphoprotein that binds and inhibits transactivation by tumor protein p53, as part of an autoregulatory negative feedback loop. Overexpression of this gene can result in excessive inactivation of tumor protein p53, diminishing its tumor suppressor function. This protein has E3 ubiquitin ligase activity, which targets tumor protein p53 for proteasomal degradation. This protein also affects the cell cycle, apoptosis, and tumorigenesis through interactions with other proteins, including retinoblastoma 1 and ribosomal protein L5. More than 40 different alternatively spliced transcript variants have been isolated from both tumor and normal tissues. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MDM2 antibody, anti-Mdm2 antibody, anti-transformed 3T3 cell double minute 2 antibody, anti-p53 binding protein (mouse) antibody, anti-HGNC:6973 antibody, anti-MGC71221 antibody, anti-hdm2 antibody, anti-mouse double minute 2 homolog antibody, anti-mouse double minute 2 antibody, anti-human homolog of antibody, anti-p53-binding protein antibody, anti-p53-binding protein MDM2 antibody, anti-ubiquitin-protein ligase E3 Mdm2 antibody |
| ProteinTarget: | MDM2 - Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 4193 |
| Gene_Symbol: | MDM2 |
| Omim_ID: | 164785 NB100-2827 |