| CatalogCode: | H00004172-M04 |
| ProductType: | Primary Antibody |
| ProductName: | MCM3 Antibody |
| ListPrice: | 295 |
| Clonality: | Monoclonal |
| Gene_Id: | 4172 |
| Host: | Mouse |
| Clone: | 2H3 |
| Isotype: | IgG2a Kappa |
| ProductDescription: | Mouse Monoclonal anti-MCM3 - MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), (2H3) |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the |
| ALTnames: | anti-HCC5 antibody, anti-MGC1157 antibody, anti-P1-MCM3 antibody, anti-P1.h antibody, anti-RLFB antibody |
| Immunogen: | MCM3 (NP_002379, 699 a.a. ~ 809 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Epitope: | AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Preservative: | No Preservative |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| PackageSize: | 0.1 mg |
| Uses: | This antibody works for Western Blot and ELISA. |
| AppSummary: | ELISA, WB |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |