ExactAntigen

MAN2A1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004124-M01
Product Type:Primary Antibody
Product Name:MAN2A1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:4124
Host:Mouse
Clone:1G9
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-MAN2A1 (1G9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = MAN2A1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes
Alternate Names:anti-MANA2 antibody, anti-MANII antibody
Immunogen:MAN2A1 (NP_002363, 1045 a.a. ~ 1145 a.a) partial recombinant protein with GST tag.
Epitope:DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR* ...
Specificity:MAN2A1 - mannosidase, alpha, class 2A, member 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:MAN2A1
Omim ID:154582,
see all human MAN2A1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about