ExactAntigen

MAL Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00004118-B01
Product Type:Primary Antibody
Product Name:MAL Antibody
List Price:295
Clonality:Polyclonal
Gene ID:4118
Host:Mouse
Product Description:Mouse Polyclonal anti-MAL - mal, T-cell differentiation protein, MaxPab Antibody
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal trans
Immunogen:MAL (AAH00458, 1 a.a. ~ 154 a.a) full-length human protein.
Epitope:MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS* ...
Preservative:No Preservative
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
see all human MAL antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about