| Catalog Code: | H00004118-B01 |
| Product Type: | Primary Antibody |
| Product Name: | MAL Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 4118 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-MAL - mal, T-cell differentiation protein, MaxPab Antibody |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal trans |
| Immunogen: | MAL (AAH00458, 1 a.a. ~ 154 a.a) full-length human protein. |
| Epitope: | MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS* ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |