| CatalogCode: | H00004100-A01 |
| ProductName: | MAGEA1 Antibody |
| Product Description: | Mouse Polyclonal anti-MAGEA1 |
| Clonality: | Polyclonal |
| Immunogen: | MAGEA1 (NP_004979, 98 a.a. ~ 172 a.a) partial recombinant protein with GST tag. |
| Epitope: | FRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVL* ... |
| Specificity: | MAGEA1 - melanoma antigen family A, 1 (directs expression of antigen MZ2-E) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MAGE1 antibody, anti-MGC9326 antibody |
| ProteinTarget: | MAGEA1 - melanoma antigen family A, 1 (directs expression of antigen MZ2-E) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 4100 |
| Gene_Symbol: | MAGEA1 |
| Omim_ID: | 300016 H00004110-M01 |