ExactAntigen

Mouse Monoclonal anti-SMAD7 (4G11) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00004092-M07
ProductName: SMAD7 Antibody
Product Description: Mouse Monoclonal anti-SMAD7 (4G11)
Clone: 4G11
Clonality: Monoclonal
Immunogen: SMAD7 (NP_005895, 160 a.a. ~ 261 a.a) partial recombinant protein with GST tag.
Epitope: CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSH* ...
Specificity: SMAD7
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA. The antibody is also shown to be specific in Western blot against cell lysates.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Host_Name: Mouse
Buffer: PBS< pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-MADH7 antibody, anti-MADH8 antibody
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 4092
Gene_Symbol: SMAD7
Omim_ID: 602932,
more information: company product webpage
Also see:
see all human SMAD7 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about