| CatalogCode: | H00004089-M06 |
| ProductName: | SMAD, mothers against DPP homolog 4 Antibody |
| Product Description: | Mouse Monoclonal anti-SMAD, mothers against DPP homolog 4 (2G4) |
| Clone: | 2G4 |
| Clonality: | Monoclonal |
| Immunogen: | SMAD4 (NP_005350, 56 a.a. ~ 166 a.a) partial recombinant protein with GST tag. |
| Epitope: | SLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHD* ... |
| Specificity: | SMAD, mothers against DPP homolog 4 (Drosophila) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DPC4 antibody, anti-JIP antibody, anti-MADH4 antibody |
| ProteinTarget: | SMAD, mothers against DPP homolog 4 (Drosophila) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 4089 |
| Gene_Symbol: | SMAD4 |
| Omim_ID: | 174900, 175050, 600993, |
order or
more information: | company product webpage |
| request information: |
|