ExactAntigen

Mouse Monoclonal anti-SMAD4 (3B9) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00004089-M01
ProductName: SMAD4 Antibody
Product Description: Mouse Monoclonal anti-SMAD4 (3B9)
Clone: 3B9
Clonality: Monoclonal
Immunogen: SMAD4 (AAH02379, 1 a.a. ~ 553 a.a) full length recombinant protein with GST tag.
Epitope: MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTG ...
Specificity: SMAD4 - SMAD, mothers against DPP homolog 4 (Drosophila)
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-DPC4 antibody, anti-JIP antibody, anti-MADH4 antibody
ProteinTarget: SMAD4 - SMAD, mothers against DPP homolog 4 (Drosophila)
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 4089
Gene_Symbol: SMAD4
Omim_ID: 174900, 175050, 600993,
more information: company product webpage
Also see:
see all human SMAD4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about