| CatalogCode: | H00004088-M23 |
| ProductName: | SMAD3 Antibody |
| Product Description: | Mouse Monoclonal anti-SMAD3 (2F1) |
| Clone: | 2F1 |
| Clonality: | Monoclonal |
| Immunogen: | SMAD3 (NP_005893, 147 a.a. ~ 270 a.a) full length recombinant protein with GST tag. |
| Epitope: | PAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFC ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DKFZP586N0721 antibody, anti-DKFZp686J10186 antibody, anti-HSPC193 antibody, anti-HsT17436 antibody, anti-JV15-2 antibody, anti-MADH3 antibody, anti-MGC60396 antibody, anti-Smadanti-3 antibody |
| ProteinTarget: | SMAD, mothers against DPP homolog 3 (Drosophila) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 4088 |
| Gene_Symbol: | SMAD3 |
| Omim_ID: | 603109, |
order or
more information: | company product webpage |
| request information: |
|